KMD Bioscience Co., Ltd.
400-621-6806
Service Line：+1-315-239-3085
Address：FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
| Catalog Number | KMH1085 |
|---|---|
| Product Name | Recombinant Human FGF Basic/FGF2 Protein, No Tag |
| Product Description | Recombinant Human FGF Basic/FGF2 Protein, No Tag (KMH1085) contains the human FGF2(Gly132-Ser288) was fused without Tag and expressed in E. coli. |
| Synonym | basic Fibroblast Growth Factor, BFGF, FGFB, FGF 2, HBGF 2, fibroblast growth factor 2 |
| Size | 50ug, 500ug, 1mg |
| Species | Human |
| Host | E.coli |
| Uniprot ID | P09038-4 |
| Sequence | GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPD GRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLAS KCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPG QKAILFLPMSAKS |
| Tag | No Tag |
| Predicted N-terminus | Met |
| Purity | > 95% as determined by Tris-Bis PAGE,> 95% as determined by HPLC |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Endotoxin | Less than 0.001 ng/ug (0.01 EU/ug) as determined by LAL test. |
| Buffer | Lyophilized from a 0.2 um filtered solution of 20mM Tris, 150mM NaCl, 3% Trehalose, 4% Mannitol, pH 7.5 |
| Biological Activity | Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is 1.11 ng/ml. (Regularly tested) |
| Background | FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. |
| Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Note | This product is for research use only. |
FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
Hot Line： +1-315-239-3085
Technical Support：sales@kmdbiosci.com
