KMD Bioscience Co., Ltd.
400-621-6806
Service Line：+1-315-239-3085
Address：FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
| Catalog Number | KMP4930 |
|---|---|
| Product Name | Recombinant Human Numa1 Protein, His Tag |
| Product Description | Recombinant Human Numa1 Protein, His Tag (KMP4930) contains the human Numa1(Q14980) Val1767-Thr2093 was fused with N-his Tag and expressed in E. coli. |
| Synonym | Centrophilin stabilizes mitotic spindle in mitotic cells Protein, NMP 22 Protein, Nuclear matrix protein 22 Protein, Nuclear mitotic apparatus protein Protein, Nuclear mitotic apparatus protein 1 Protein, NUMA Protein, NUMA 1 Protein, NuMA protein Protein, NUMA1 Protein, NUMA1_HUMAN Protein, SP H antigen Protein, SP-H antigen Protein, Structural nuclear protein Protein |
| Size | 50ug, 200ug, 1mg |
| Species | Human |
| Host | E.coli |
| Uniprot ID | Q14980 |
| Sequence | VESLESLYFTPIPARSQAPLESSLDSLGDVFLDSGRKTRSARRRTTQIIN ITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYG NSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDD WNRIAELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLR RASMQPIQIAEGTGITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTP RDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLR RGASKKALSKASPNTRSGTRRSPRIATT |
| Molecular Weight | 37.7kDa |
| Tag | His |
| Predicted N-terminus | His |
| Purity | Greater than 95% as determined by SDS-PAGE |
| Formulation | Lyophilized |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Appllications | Western Blot, ELISA |
| Buffer | Lyophilized from a 0.2 um filtered solution in PBS with 5% trehalose, pH7.4 |
| Background | Healthy individuals generally have very small amounts of NMP22 protein in the urine. However, the level of NMP22 protein is often elevated in the urine of patients with bladder cancer, even at early stages of the disease.1 The Alere NMP22 Test is an enzyme immunoassay for the quantitative determination of nuclear mitotic apparatus protein (NuMA) in stabilized voided urine. NuMA is an abundant component of the nuclear matrix proteins (NMP22). The Alere NMP22 BladderChek Test is the only in-office test approved by the FDA as an aid in the diagnosis and monitoring of bladder cancer in conjunction with standard diagnostic procedures. Both assays are painless and non-invasive and detect elevated levels of NMP22 protein. |
| Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Note | This product is for research use only. |
FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
Hot Line： +1-315-239-3085
Technical Support：sales@kmdbiosci.com
