KMD Bioscience Co., Ltd.
400-621-6806
Service Line：+1-315-239-3085
Address：FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
| Catalog Number | KMPH1232 |
|---|---|
| Product Name | Human IL18 Protein |
| Product Description | KMPH1232, Human IL18 Protein is expressed from E.coli without tag. It contains Tyr37-Asp193. |
| Synonym | IL18, interleukin 18, IGIF, IL-18, IL-1g, IL1F4 |
| Size | 10ug, 100ug, 500ug, 1mg |
| Species | Human |
| Host | E.coli |
| Uniprot ID | Q14116-1 |
| Sequence | YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFII SMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKS DIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL GDRSIMFTVQNED |
| Molecular Weight | The protein has a predicted MW of 18.2 kDa same as Tris-Bis PAGE result. |
| Tag | No Tag |
| Predicted N-terminus | Tyr 37 |
| Purity | > 95% as determined by Tris-Bis PAGE,> 95% as determined by HPLC |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Endotoxin | Less than 1EU per ug by the LAL method. |
| Buffer | Lyophilized from 0.22um filtered solution in 20mM PB, 250mM NaCl, 50mM L-arginine (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization. |
| Biological Activity | Immobilized Human IL-18 at 5ug/ml (100ul/Well) on the plate. Dose response curve for Human IL-18BP, hFc Tag with the EC50 of 16.9ng/ml determined by ELISA (QC Test). |
| Background | Interleukin (IL)-18 was originally discovered as a factor that enhanced IFN-γ production from anti-CD3-stimulated Th1 cells, especially in the presence of IL-12. Upon stimulation with Ag plus IL-12, naïve T cells develop into IL-18 receptor (IL-18R) expressing Th1 cells, which increase IFN-γ production in response to IL-18 stimulation. |
| Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Note | This product is for research use only. |
FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
Hot Line： +1-315-239-3085
Technical Support：sales@kmdbiosci.com
