KMD Bioscience Co., Ltd.
400-621-6806
Service Line：+1-315-239-3085
Address：FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
| Catalog Number | MOP1120 |
|---|---|
| Product Name | Mouse IL1B Protein |
| Product Description | Mouse IL1B Protein contains the mature form of mouse IL1β (P10749) (Val 118-Ser 269) was expressed with an initial Met at the C-terminus and expressed from E. coli. |
| Synonym | IL1B, interleukin 1 beta, IL-1, IL1F2, IL1-BETA |
| Size | 20ug, 100ug, 1mg |
| Species | Mouse |
| Host | E.coli |
| Uniprot ID | P10749 |
| Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQG EPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKR FVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFT MESVSS |
| Tag | No Tag |
| Predicted N-terminus | Met |
| Purity | > 95 % as determined by SDS-PAGE |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Endotoxin | Less than 0.001 ng/ug (0.01 EU/ug) as determined by LAL test. |
| Buffer | Lyophilized from sterile PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. |
| Biological Activity | Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is typically 6-30 ng/mL. |
| Background | Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family. IL1 is a pleiotropic cytokine. It is involved in the inflammatory response, cell growth, and tissue repair in the cortex. The IL1 superfamily consists of three members, IL1A (IL1 alpha), IL1B (IL1 beta), and IL1 receptor antagonist (IL1Ra). In clinical, it has been reported that Interleukin (IL)-1 may influence Th1 / Th2 immune responsiveness and has been implicated in the establishment of a successful pregnancy. Proinflammatory interleukin (IL)-1 gene polymorphisms associated with high levels of IL-1beta activity increase the risk for hypochlorhydria and distal gastric carcinoma. IL1B polymorphisms may be involved in susceptibility to SSc. Moreover, the IL2-384-G allele may be a marker for the limited phenotype of systemic sclerosis (SSc). |
| Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Note | This product is for research use only. |
FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
Hot Line： +1-315-239-3085
Technical Support：sales@kmdbiosci.com
