KMD Bioscience Co., Ltd.
400-621-6806
Service Line：+1-315-239-3085
Address：FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
| Catalog Number | KMP3579 |
|---|---|
| Product Name | Human EGF Protein |
| Product Description | Human EGF Protein is expressed from E.coli without tag.It contains Asn971-Arg1023. |
| Synonym | Epithelial Growth Factor, Human EGF Protein, EGF |
| Size | 100ug, 500ug, 1mg |
| Species | Human |
| Host | E.coli |
| Uniprot ID | P01133-1 |
| Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Molecular Weight | The protein has a predicted MW of 5.6 kDa same as Tris-Bis PAGE result. |
| Tag | No Tag |
| Predicted N-terminus | Met |
| Purity | > 95% as determined by Tris-Bis PAGE,> 95% as determined by HPLC |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Endotoxin | Less than 1EU per ug by the LAL method. |
| Buffer | Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization. |
| Biological Activity | Immobilized Human EGF, No Tag at 2ug/ml (100ul/well) on the plate. Dose response curve for Human EGFR, hFc Tag with the EC50 of 0.82ug/ml determined by ELISA. |
| Background | The epidermal growth factor (EGF) family of peptides encodes several proteins that can function as growth factors. The EGF-like peptides, with the exception of proteins of the EGF-CFC subfamily, bind and activate tyrosine kinase receptors that belong to the erbB family. |
| Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Note | This product is for research use only. |
FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：info@kmdbioscience.com
Hot Line： +1-315-239-3085
Technical Support：sales@kmdbiosci.com
