KMD Bioscience Co., Ltd.
400-621-6806
Service Line：+86-022-82164980
Address：FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：[email protected]
| Catalog Number | KMP2551 |
|---|---|
| Product Name | Human Flt3 Ligand Protein |
| Product Description | Human FLT3 Ligand Protein is expressed from E.coli without tag.It contains Thr27-Ala181. |
| Synonym | FL Protein, Human, FLT3L Protein, Human, FLT3LG Protein, Human |
| Size | 20ug, 100ug, 500ug, 1mg |
| Species | Human |
| Host | E.coli |
| Uniprot ID | P49771-1 |
| Sequence | QDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLV LAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPL EATAPTA |
| Molecular Weight | The protein has a predicted MW of 17.61 kDa same as Tris-Bis PAGE result. |
| Tag | No Tag |
| Purity | > 95% as determined by Tris-Bis PAGE,> 95% as determined by HPLC |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Endotoxin | Less than 1EU per ug by the LAL method. |
| Buffer | Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization. |
| Biological Activity | The ED50 for this effect is typically 1-6 ng/mL. |
| Background | Flt‑3 Ligand, also known as FL, is an alpha -helical cytokine that promotes the differentiation of multiple hematopoietic cell lineages.Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
| Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Note | This product is for research use only. |
FL-4, Building A5, International Enterprise Community, Tianjin, China
Email：[email protected]
Hot Line： +86-022-82164980
Technical Support：[email protected]
