Contact Us

Service Line:+86-022-82164980

Address:FL-4, Building A5, International Enterprise Community, Tianjin, China

Email:[email protected]

Online Inquery

  •   
  •   
  •   
  • Refresh

Recombinant Mouse Flt-3 Ligand/Flt3 Protein, His Tag

Product Information
Catalog Number MOP2159
Product Name Recombinant Mouse Flt-3 Ligand/Flt3 Protein, His Tag
Product Description Recombinant Mouse Flt-3 Ligand/Flt3 Protein, His Tag (MOP2159) contains the mouse Flt3(Gly27-Arg188) was fused with the C-terminal His Tag and expressed in Mammalian cells.
Synonym Flk2, Ly72, wmfl, CD135, Flk 2, Flt 3, B230315G04, FMS like tyrosine kinase 3
Size 50ug, 100ug, 500ug, 1mg
Species Mouse
Host Mammalian cells
Uniprot ID P49772-1
Sequence TPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWS LFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQ TNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPR SPIALEATELPEPRPR
Molecular Weight The protein has a predicted MW of 19.4 kDa.
Tag his tag
Purity > 95% as determined by Tris-Bis PAGE,> 95% as determined by HPLC
Reconstitution Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.
Endotoxin < 1.0 EU per ug of the protein as determined by the LAL method.
Buffer Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Biological Activity Immobilized Mouse FLT3 Ligand, His Tag at 1ug/ml (100ul/well) on the plate. Dose response curve for Human FLT3, hFc Tag with the EC50 of 23.7ng/ml determined by ELISA (QC Test). The affinity constant of 0.18 nM as determined in SPR assay (Biacore T200). See testing image for detail.
Background Flt‑3 Ligand, also known as FL, is an alpha -helical cytokine that promotes the differentiation of multiple hematopoietic cell lineages.Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Storage Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Note This product is for research use only.