Service Line:+1-315-239-3085
Address:FL-4, Building A5, International Enterprise Community, Tianjin, China
Email:info@kmdbioscience.com
Catalog Number | MOP2159 |
---|---|
Product Name | Recombinant Mouse Flt-3 Ligand/Flt3 Protein, His Tag |
Product Description | Recombinant Mouse Flt-3 Ligand/Flt3 Protein, His Tag (MOP2159) contains the mouse Flt3(Gly27-Arg188) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Synonym | Flk2, Ly72, wmfl, CD135, Flk 2, Flt 3, B230315G04, FMS like tyrosine kinase 3 |
Size | 50ug, 100ug, 500ug, 1mg |
Species | Mouse |
Host | Mammalian cells |
Uniprot ID | P49772-1 |
Sequence | TPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWS LFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQ TNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPR SPIALEATELPEPRPR |
Molecular Weight | The protein has a predicted MW of 19.4 kDa. |
Tag | his tag |
Purity | > 95% as determined by Tris-Bis PAGE,> 95% as determined by HPLC |
Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
Endotoxin | < 1.0 EU per ug of the protein as determined by the LAL method. |
Buffer | Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization. |
Biological Activity | Immobilized Mouse FLT3 Ligand, His Tag at 1ug/ml (100ul/well) on the plate. Dose response curve for Human FLT3, hFc Tag with the EC50 of 23.7ng/ml determined by ELISA (QC Test). The affinity constant of 0.18 nM as determined in SPR assay (Biacore T200). See testing image for detail. |
Background | Flt‑3 Ligand, also known as FL, is an alpha -helical cytokine that promotes the differentiation of multiple hematopoietic cell lineages.Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Note | This product is for research use only. |